RetrogeneDB ID: | retro_cjac_1178 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 14:4548787..4549128(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RAB31 | ||
Ensembl ID: | ENSCJAG00000004529 | ||
Aliases: | None | ||
Description: | RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:9771] |
Percent Identity: | 72.65 % |
Parental protein coverage: | 57.95 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 4 |
Parental | VIVYDIT-KQDSFYTLKKWVKELKEHGPENIVMAIAG-NKCDLSDIREVPLKDAKEYAESIGAI-VVETS |
..V.D.T.KQDSF.TLKKW..ELKEHGPENI.M.IA..NKC.LSDIRE..LKDA.EYAE.IGAI.VVE.. | |
Retrocopy | ITVHDVT>KQDSFHTLKKWDEELKEHGPENIQMVIAE<NKCHLSDIREIFLKDAEEYAEFIGAI>VVEAR |
Parental | AK-NAINIEELFQGISRQIPPLDHHENGNNGAIKLVKQTTQASRRCC |
AK.N.INIEELFQGIS.QIP.LD.HENGNNG...L..QT.QAS.RCC | |
Retrocopy | AK>NPINIEELFQGISHQIPALDPHENGNNGVRRLGEQTMQASLRCC |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 25 .12 RPM |
SRP051959_heart | 0 .00 RPM | 43 .43 RPM |
SRP051959_kidney | 0 .00 RPM | 33 .30 RPM |
SRP051959_liver | 0 .00 RPM | 41 .63 RPM |
SRP051959_lung | 0 .00 RPM | 68 .62 RPM |
SRP051959_lymph_node | 0 .00 RPM | 19 .25 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 7 .29 RPM |
SRP051959_spleen | 0 .00 RPM | 64 .77 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000000472 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000003731 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004529 | 2 retrocopies |
retro_cjac_1178 , retro_cjac_1179,
|
Callithrix jacchus | ENSCJAG00000007527 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019039 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000002882 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005692 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000021443 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000016514 | 1 retrocopy |