RetrogeneDB ID: | retro_cjac_1343 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 15:54157908..54158348(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HINT2 | ||
Ensembl ID: | ENSCJAG00000010068 | ||
Aliases: | None | ||
Description: | histidine triad nucleotide binding protein 2 [Source:HGNC Symbol;Acc:18344] |
Percent Identity: | 63.58 % |
Parental protein coverage: | 92.02 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 1 |
Parental | AARRAVAAARVRGAQVRGAAGVTDGNEVTKAQQATPGGAAPTIFSRILDRSLPADILYEDQQCLVFRDVA |
A.RRA.AA...R.A...GA.GVT.GNE..K.Q.AT..G.APTIF.RILD.SLPA.ILYED.QCL.F.DVA | |
Retrocopy | ALRRAMAAMGWRSAHI*GAGGVTGGNETSKGQLATCKGVAPTIFYRILDHSLPAYILYED*QCLLFPDVA |
Parental | PQAPVHFLVIPKKPIPRISQAEEED-QQLLGHLLIVAKKIAKAEGLGDGYRLVINDGKLGAQSVYHLHIH |
P.AP..FLVIPKKPIP.I.QAEEE..Q.L...LL...KK.A...G..DGY.LVIND.KL.AQSV..LH.. | |
Retrocopy | P*APMNFLVIPKKPIPHINQAEEES<QLLAHLLL-MSKK*AEGLG--DGY*LVINDEKLSAQSVNYLHVY |
Parental | VLGGRQLQWPP |
.LG..QL.WPP | |
Retrocopy | LLGS*QLWWPP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 4 .66 RPM |
SRP051959_heart | 0 .09 RPM | 5 .49 RPM |
SRP051959_kidney | 0 .02 RPM | 8 .70 RPM |
SRP051959_liver | 0 .00 RPM | 7 .28 RPM |
SRP051959_lung | 0 .05 RPM | 2 .44 RPM |
SRP051959_lymph_node | 0 .05 RPM | 2 .37 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 9 .46 RPM |
SRP051959_spleen | 0 .00 RPM | 2 .96 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2603 |
Pan troglodytes | retro_ptro_1754 |
Gorilla gorilla | retro_ggor_1823 |
Pongo abelii | retro_pabe_2310 |
Macaca mulatta | retro_mmul_1509 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy |
retro_cjac_1343 ,
|
Callithrix jacchus | ENSCJAG00000014398 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
Homo sapiens | ENSG00000137133 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |