RetrogeneDB ID: | retro_cjac_1343 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 15:54157908..54158348(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HINT2 | ||
| Ensembl ID: | ENSCJAG00000010068 | ||
| Aliases: | None | ||
| Description: | histidine triad nucleotide binding protein 2 [Source:HGNC Symbol;Acc:18344] |
| Percent Identity: | 63.58 % |
| Parental protein coverage: | 92.02 % |
| Number of stop codons detected: | 6 |
| Number of frameshifts detected: | 1 |
| Parental | AARRAVAAARVRGAQVRGAAGVTDGNEVTKAQQATPGGAAPTIFSRILDRSLPADILYEDQQCLVFRDVA |
| A.RRA.AA...R.A...GA.GVT.GNE..K.Q.AT..G.APTIF.RILD.SLPA.ILYED.QCL.F.DVA | |
| Retrocopy | ALRRAMAAMGWRSAHI*GAGGVTGGNETSKGQLATCKGVAPTIFYRILDHSLPAYILYED*QCLLFPDVA |
| Parental | PQAPVHFLVIPKKPIPRISQAEEED-QQLLGHLLIVAKKIAKAEGLGDGYRLVINDGKLGAQSVYHLHIH |
| P.AP..FLVIPKKPIP.I.QAEEE..Q.L...LL...KK.A...G..DGY.LVIND.KL.AQSV..LH.. | |
| Retrocopy | P*APMNFLVIPKKPIPHINQAEEES<QLLAHLLL-MSKK*AEGLG--DGY*LVINDEKLSAQSVNYLHVY |
| Parental | VLGGRQLQWPP |
| .LG..QL.WPP | |
| Retrocopy | LLGS*QLWWPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 4 .66 RPM |
| SRP051959_heart | 0 .09 RPM | 5 .49 RPM |
| SRP051959_kidney | 0 .02 RPM | 8 .70 RPM |
| SRP051959_liver | 0 .00 RPM | 7 .28 RPM |
| SRP051959_lung | 0 .05 RPM | 2 .44 RPM |
| SRP051959_lymph_node | 0 .05 RPM | 2 .37 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 9 .46 RPM |
| SRP051959_spleen | 0 .00 RPM | 2 .96 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2603 |
| Pan troglodytes | retro_ptro_1754 |
| Gorilla gorilla | retro_ggor_1823 |
| Pongo abelii | retro_pabe_2310 |
| Macaca mulatta | retro_mmul_1509 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000011444 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000010068 | 1 retrocopy |
retro_cjac_1343 ,
|
| Callithrix jacchus | ENSCJAG00000014398 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000000419 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009083 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000017929 | 1 retrocopy | |
| Homo sapiens | ENSG00000137133 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011265 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000015022 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000026914 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027206 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000011830 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000019082 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000020923 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003028 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000013020 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000002700 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011932 | 1 retrocopy |