RetrogeneDB ID: | retro_cjac_1978 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 2:182845522..182845819(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSCJAG00000009945 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 92. % |
Parental protein coverage: | 85.47 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EDLKDPEVFQVQTRLLEAMFAGRDGCRIPYIEQVSKAMLELKALESPDFTEVVVYGSYIYKLRAKWMLQS |
EDLKDPEVFQVQ..L.EAMF.GRD.C.IPYIEQVSKAMLELKALESPDFTEVVVYGSYIYKLRAKWMLQS | |
Retrocopy | EDLKDPEVFQVQMQLMEAMF-GRDRCQIPYIEQVSKAMLELKALESPDFTEVVVYGSYIYKLRAKWMLQS |
Parental | MAEWHRQRQERGMLKLEEAMNALELSPWMN |
MAEWH.QRQERGMLKLE.AMNALELSPWMN | |
Retrocopy | MAEWHCQRQERGMLKLEKAMNALELSPWMN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 0 .00 RPM |
SRP051959_heart | 0 .00 RPM | 0 .16 RPM |
SRP051959_kidney | 0 .00 RPM | 0 .02 RPM |
SRP051959_liver | 0 .00 RPM | 0 .00 RPM |
SRP051959_lung | 0 .00 RPM | 0 .07 RPM |
SRP051959_lymph_node | 0 .00 RPM | 0 .02 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
SRP051959_spleen | 0 .00 RPM | 0 .04 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies |
retro_cjac_1978 , retro_cjac_62, retro_cjac_85,
|
Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
Homo sapiens | ENSG00000203909 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060461 | 7 retrocopies | |
Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |