RetrogeneDB ID: | retro_ggor_1489 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 19:49834149..49834440(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DPPA5 | ||
Ensembl ID: | ENSGGOG00000012001 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 80.41 % |
Parental protein coverage: | 83.62 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVVYGSYLYKLRTKWMLQSMAE |
LKDPEV.QVQ..LL.AIFGPD.S.IPYIEQVSK.ML.LKALESSDLTE.V.YGSYLYK..TKWM.QSMAE | |
Retrocopy | LKDPEVLQVQMQLLEAIFGPD*SQIPYIEQVSKVMLVLKALESSDLTEAVIYGSYLYKCQTKWMPQSMAE |
Parental | WHRQRQERGMLKLAEAMNALELGPWMK |
WH.QRQERGMLKLAE.MNA..L.PW.K | |
Retrocopy | WHCQRQERGMLKLAESMNAVKLRPWVK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .04 RPM | 0 .04 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .31 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2067 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
Homo sapiens | ENSG00000203909 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy |
retro_ggor_1489 ,
|
Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
Mus musculus | ENSMUSG00000060461 | 7 retrocopies | |
Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |