RetrogeneDB ID: | retro_dnov_53 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | GeneScaffold_1052:60912..61260(+) | ||
| Located in intron of: | ENSDNOG00000004754 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSDNOG00000011544 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.9 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGTLPERKDIPPWVKVPEDLRDPEVFQVQTRLLEAMFGPQGSRIPYIEQVSKAMLELKVLESSDLTEVVV |
| MGTLPE.KDIP.WVKV.EDL.DPEVFQVQTRLLEAMFGP.GS.IPYIEQVSKAML.LKVLESSDLT..VV | |
| Retrocopy | MGTLPEQKDIPLWVKVTEDLKDPEVFQVQTRLLEAMFGPHGSQIPYIEQVSKAMLKLKVLESSDLTKMVV |
| Parental | YGNYLYKLRTKWMLQSLAEWHRQRQEREMLRLEEAMNALELGPWTQ |
| .GNYLYK..TK.M.Q.LA.WH.QRQER.MLRLEEAMNAL.LG.W.Q | |
| Retrocopy | *GNYLYKFQTKRMRQALAKWHLQRQERGMLRLEEAMNALKLGSWMQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 0 .00 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .00 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .00 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 0 .00 RPM |
| SRP012922_spleen | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002647 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000012338 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000009945 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000011544 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000000378 | 2 retrocopies | |
| Homo sapiens | ENSG00000203909 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012001 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000018513 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004463 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000000417 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000060461 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000016771 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000029547 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000199 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000004283 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000005326 | 2 retrocopies |