RetrogeneDB ID: | retro_cjac_1984 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 20:3718315..3718610(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C8orf59 | ||
Ensembl ID: | ENSCJAG00000000379 | ||
Aliases: | None | ||
Description: | chromosome 8 open reading frame 59 [Source:HGNC Symbol;Acc:32235] |
Percent Identity: | 64.71 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAKNKLRGPKSRNVFHIAS-QKNFKAKNKAKPVTTNLKKINIMNEEKINRVNKAFVDVQKELAHFSKGLS |
MAKNKLRGPKS.NVFHIAS..KNFKAKNK.KPVTTNLKKINIM...K.....K........L....K... | |
Retrocopy | MAKNKLRGPKSGNVFHIAS<LKNFKAKNKTKPVTTNLKKINIM-KKKLTE*IKLL*MYKRNLHISQKAFH |
Parental | LDPLQKE-LIPQRRHESKPVNVDEATKLMAQL |
L....K..LIPQ..HES.PVNVDEATKLMAQL | |
Retrocopy | LNRCRKS<LIPQQHHESNPVNVDEATKLMAQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .07 RPM | 3 .93 RPM |
SRP051959_heart | 0 .09 RPM | 11 .79 RPM |
SRP051959_kidney | 0 .11 RPM | 7 .21 RPM |
SRP051959_liver | 0 .06 RPM | 6 .65 RPM |
SRP051959_lung | 0 .18 RPM | 7 .26 RPM |
SRP051959_lymph_node | 0 .11 RPM | 7 .01 RPM |
SRP051959_skeletal_muscle | 0 .07 RPM | 11 .44 RPM |
SRP051959_spleen | 0 .11 RPM | 7 .16 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |