RetrogeneDB ID: | retro_ggor_1353 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 17:56575372..56575644(-) | ||
Located in intron of: | ENSGGOG00000015352 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C8ORF59 | ||
Ensembl ID: | ENSGGOG00000027464 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.91 % |
Parental protein coverage: | 93. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEE-KVNRVNKAFVNVQKELAHFAKSIS |
MAKNKLRG.KSRNVFH..SQ.NFKAKNKAKPVTTNLK.IN.MN.E.KVN.VNKAFVN.QKEL..F.K..S | |
Retrocopy | MAKNKLRGQKSRNVFHMVSQNNFKAKNKAKPVTTNLK-INVMNDE<KVNNVNKAFVNIQKEL-NFSKALS |
Parental | LEPLQKELIPQQRHESKPVNVDEA |
LEPLQKE.IPQ.RHESKPVNVDEA | |
Retrocopy | LEPLQKEPIPQKRHESKPVNVDEA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .80 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .79 RPM |
SRP007412_heart | 0 .00 RPM | 3 .47 RPM |
SRP007412_kidney | 0 .04 RPM | 21 .10 RPM |
SRP007412_liver | 0 .00 RPM | 18 .20 RPM |
SRP007412_testis | 0 .21 RPM | 19 .68 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3163 |
Pan troglodytes | retro_ptro_2275 |
Pongo abelii | retro_pabe_2630 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |