RetrogeneDB ID: | retro_mmul_1475 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:159639969..159640232(+) | ||
Located in intron of: | ENSMMUG00000023776 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C8H8orf59 | ||
Ensembl ID: | ENSMMUG00000006381 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 65.93 % |
Parental protein coverage: | 89. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MGKNK-LRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNDEKVNRVNKAFVNVQKE-LAHFSKGP |
M.KNK..RG.K..NVFHIAS.KNF...NKA.P.TTNL...N..N.EKV.RVNK..V..QK..LAHFSKG. | |
Retrocopy | MAKNK>IRGKKPSNVFHIAS*KNFRVQNKANPITTNL--VNNLNVEKVSRVNKVLVHIQKK>LAHFSKGL |
Parental | SVEPLQKELIPQQRHESKPVN |
S.EPLQK.LIPQQ.H..KPVN | |
Retrocopy | SLEPLQKQLIPQQHHKNKPVN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 3 .59 RPM |
SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 3 .33 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .87 RPM |
SRP007412_heart | 0 .06 RPM | 4 .65 RPM |
SRP007412_kidney | 0 .00 RPM | 5 .99 RPM |
SRP007412_liver | 0 .00 RPM | 2 .22 RPM |
SRP007412_testis | 0 .04 RPM | 4 .07 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2609 |
Pan troglodytes | retro_ptro_1759 |
Gorilla gorilla | retro_ggor_1828 |
Pongo abelii | retro_pabe_2345 |
Callithrix jacchus | retro_cjac_1556 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies |
retro_mmul_1475 , retro_mmul_2490, retro_mmul_537,
|
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |