RetrogeneDB ID: | retro_lafr_1242 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_927:12112..12355(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSLAFG00000032612 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.84 % |
Parental protein coverage: | 75. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | QKNFKSKNKAKPVTTNLKKINIVNDEKVNRVNKAFVDIQKELAHFSKGLTLEPLQKQ---LQHQENEPVN |
....K.KNKAKPV..NLKKI.IVN.EKVN.VN.AFVDI.KEL.HFSKGL..E.LQKQ....QH.EN.PVN | |
Retrocopy | RQKIKAKNKAKPVSVNLKKIHIVNEEKVN*VN*AFVDIRKELVHFSKGLSFELLQKQRILQQHHENKPVN |
Parental | VDEATRLMAQL |
VDEATRLMAQL | |
Retrocopy | VDEATRLMAQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |