RetrogeneDB ID: | retro_pabe_2345 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:130205270..130205533(-) | ||
Located in intron of: | ENSPPYG00000014078 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000029910 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.03 % |
Parental protein coverage: | 89. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MAKNKL-RGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQK-ELAHFSKST |
MAKNKL.RG.KS.NVFHI.S.KNF...NKAKP.TTNL...N..N..KV.RVNK.F...QK..LAHFSK.. | |
Retrocopy | MAKNKL>RGKKSSNVFHISS*KNFRVQNKAKPITTNL--VNNLNTGKVSRVNKVFIHIQK>QLAHFSKGI |
Parental | SLEPLQKELIPQQRHESKPVN |
.LEPLQK.LIPQQ.H..KPVN | |
Retrocopy | PLEPLQKRLIPQQHHDNKPVN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .33 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .77 RPM |
SRP007412_heart | 0 .00 RPM | 5 .24 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .96 RPM |
SRP007412_liver | 0 .03 RPM | 7 .80 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2609 |
Pan troglodytes | retro_ptro_1759 |
Gorilla gorilla | retro_ggor_1828 |
Macaca mulatta | retro_mmul_1475 |
Callithrix jacchus | retro_cjac_1556 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002409 | 2 retrocopies | |
Bos taurus | ENSBTAG00000032227 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000000379 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021965 | 5 retrocopies | |
Felis catus | ENSFCAG00000026366 | 1 retrocopy | |
Homo sapiens | ENSG00000176731 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000027464 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032612 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000006155 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006381 | 3 retrocopies | |
Mus musculus | ENSMUSG00000078784 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029910 | 3 retrocopies |
retro_pabe_2345 , retro_pabe_2630, retro_pabe_3633,
|
Pan troglodytes | ENSPTRG00000020385 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000038902 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000006144 | 2 retrocopies |