RetrogeneDB ID: | retro_cjac_2420 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 4:30760421..30760658(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TOMM20 | ||
Ensembl ID: | ENSCJAG00000018127 | ||
Aliases: | None | ||
Description: | translocase of outer mitochondrial membrane 20 homolog (yeast) [Source:HGNC Symbol;Acc:20947] |
Percent Identity: | 89.87 % |
Parental protein coverage: | 54.48 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQL |
R.RE.RKKQKLAKE.AGLSKLPDLKDAEA.QKFFLEEIQLGEELLAQGEYEKGVDHL.NAIAVCGQ.QQL | |
Retrocopy | RIRE*RKKQKLAKEKAGLSKLPDLKDAEAFQKFFLEEIQLGEELLAQGEYEKGVDHLMNAIAVCGQAQQL |
Parental | LQVLQQTLP |
LQ.L.QTLP | |
Retrocopy | LQLLKQTLP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 23 .70 RPM |
SRP051959_heart | 0 .00 RPM | 25 .73 RPM |
SRP051959_kidney | 0 .00 RPM | 23 .25 RPM |
SRP051959_liver | 0 .00 RPM | 34 .83 RPM |
SRP051959_lung | 0 .00 RPM | 17 .67 RPM |
SRP051959_lymph_node | 0 .00 RPM | 13 .36 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 25 .90 RPM |
SRP051959_spleen | 0 .00 RPM | 18 .68 RPM |