RetrogeneDB ID: | retro_ptro_1166 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 17:21445606..21445851(+) | ||
Located in intron of: | ENSPTRG00000030902 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TOMM20 | ||
Ensembl ID: | ENSPTRG00000002127 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75.9 % |
Parental protein coverage: | 55.86 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | RNSAIAAGVCGALFIGYCIYFDRKRR-SDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLE |
RN.AIAAGV.GALFIGYCIYFDRKR..SDPN.KNR..E.RKKQKLA.E...LSKL.DLKDAEAVQKF.LE | |
Retrocopy | RNGAIAAGVFGALFIGYCIYFDRKRL>SDPNLKNRRPE*RKKQKLAEE*VELSKLADLKDAEAVQKFLLE |
Parental | EI-QLGEELLAQG |
EI....EE.LA.G | |
Retrocopy | EI>SFSEEILAKG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .07 RPM | 200 .62 RPM |
SRP007412_cerebellum | 0 .07 RPM | 195 .41 RPM |
SRP007412_heart | 0 .09 RPM | 92 .36 RPM |
SRP007412_kidney | 0 .03 RPM | 111 .80 RPM |
SRP007412_liver | 0 .03 RPM | 75 .29 RPM |
SRP007412_testis | 0 .11 RPM | 41 .63 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1827 |
Macaca mulatta | retro_mmul_1255 |