RetrogeneDB ID: | retro_ggor_1395 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 18:8754487..8754810(-) | ||
| Located in intron of: | ENSGGOG00000016277 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TOMM20 | ||
| Ensembl ID: | ENSGGOG00000025184 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.72 % |
| Parental protein coverage: | 73.47 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EKMVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQK |
| .K..G.NSA..A.V..ALFIGYCIY...KRRSDPNFKNRL.E.RKKQKLAKERA.L.K.PDLK.AEAVQK | |
| Retrocopy | QKTLGQNSAVIARVRRALFIGYCIYLGHKRRSDPNFKNRL*EQRKKQKLAKERAELCKRPDLKVAEAVQK |
| Parental | -FFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQL |
| ..F.EEIQL.EELLAQGE.EK...HLT...A.CGQ..Q. | |
| Retrocopy | <IFFEEIQLREELLAQGECEKDMEHLTTGSAGCGQLLQV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 58 .12 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 28 .41 RPM |
| SRP007412_heart | 0 .00 RPM | 7 .60 RPM |
| SRP007412_kidney | 0 .00 RPM | 38 .31 RPM |
| SRP007412_liver | 0 .05 RPM | 22 .50 RPM |
| SRP007412_testis | 0 .00 RPM | 40 .82 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1906 |
| Pan troglodytes | retro_ptro_1252 |
| Pongo abelii | retro_pabe_1553 |