RetrogeneDB ID: | retro_cjac_2990 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 7:75121744..75122369(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GTF2F2 | ||
Ensembl ID: | ENSCJAG00000019220 | ||
Aliases: | None | ||
Description: | general transcription factor IIF, polypeptide 2, 30kDa [Source:HGNC Symbol;Acc:4653] |
Percent Identity: | 58.14 % |
Parental protein coverage: | 84.74 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | ELDLTGAKQNTG-VWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNEDLANIHDIGGKPAS |
.L.L....QN....WLV.VPKYLS..W..A.G..EVGKL..AKNQ.....SFTLNEDL.NIHDI.G.P.. | |
Retrocopy | QLNLEAIQQNSC<LWLVEVPKYLS*EWSEASGSSEVGKLQTAKNQRKSALSFTLNEDLKNIHDIDGQPTQ |
Parental | -VSAPREHP-FVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAASENYMRLKRLQIEESSKPVRLS |
.VS.PRE.P.F......G....V.TE....KLSLEG..VQR.EC.PA...N.MR.KR.Q........... | |
Retrocopy | <VSTPREAP>FLCRGSEGRS-SVLTERAPSKLSLEG-TVQRGECQPATN*NSMRRKRMQTQXXXXXXXTL |
Parental | QQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPV-V |
Q.LDKVVT..YKPVANHQYN..YE.KKKE.GKR..ADK..VL..LF.AFEKHQYYN.KD.V.IT.QPV.V | |
Retrocopy | QTLDKVVTAGYKPVANHQYNTAYEKKKKEEGKRVQADKDQVLFLLFAAFEKHQYYNIKDTVGITVQPV<V |
Parental | YLKEI |
.LKEI | |
Retrocopy | CLKEI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 10 .45 RPM |
SRP051959_heart | 0 .00 RPM | 7 .21 RPM |
SRP051959_kidney | 0 .00 RPM | 7 .92 RPM |
SRP051959_liver | 0 .00 RPM | 8 .92 RPM |
SRP051959_lung | 0 .00 RPM | 9 .21 RPM |
SRP051959_lymph_node | 0 .00 RPM | 13 .99 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 13 .95 RPM |
SRP051959_spleen | 0 .11 RPM | 12 .84 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_368 |
Pan troglodytes | retro_ptro_288 |
Gorilla gorilla | retro_ggor_379 |
Macaca mulatta | retro_mmul_483 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000028333 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000007391 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019220 | 2 retrocopies |
retro_cjac_1351, retro_cjac_2990 ,
|
Homo sapiens | ENSG00000188342 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000006657 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000010505 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000012634 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000025484 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002097 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002106 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000012517 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000005868 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000005333 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005840 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000029316 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000006891 | 1 retrocopy |