RetrogeneDB ID: | retro_cjac_3889 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | GL285858.1:19998..20319(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1A | ||
Ensembl ID: | ENSCJAG00000020908 | ||
Aliases: | None | ||
Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:F6SFB9] |
Percent Identity: | 85.98 % |
Parental protein coverage: | 73.79 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ |
GVQ.ETIS.GDG.TFP.RGQTCVVH.T.MLEDGKK.DSS.DRNKPFKFMLGKQEVI.GWEEG...M.VGQ | |
Retrocopy | GVQLETISTGDGLTFPGRGQTCVVHSTRMLEDGKKLDSSWDRNKPFKFMLGKQEVIGGWEEGFVPMGVGQ |
Parental | RAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
RAKLT.SPDYA.GATGHPGIIPPHATLVFDVELLKLE | |
Retrocopy | RAKLTTSPDYACGATGHPGIIPPHATLVFDVELLKLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .00 RPM | 10 .89 RPM |
SRP051959_heart | 0 .00 RPM | 9 .31 RPM |
SRP051959_kidney | 0 .02 RPM | 8 .19 RPM |
SRP051959_liver | 0 .00 RPM | 7 .45 RPM |
SRP051959_lung | 0 .02 RPM | 11 .13 RPM |
SRP051959_lymph_node | 0 .16 RPM | 6 .87 RPM |
SRP051959_skeletal_muscle | 0 .00 RPM | 8 .98 RPM |
SRP051959_spleen | 0 .04 RPM | 8 .30 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000007700 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018746 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Homo sapiens | ENSG00000088832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |