RetrogeneDB ID: | retro_nleu_604 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397268.1:2893182..2893418(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1C | ||
| Ensembl ID: | ENSNLEG00000009356 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:G1RDV4] |
| Percent Identity: | 81.25 % |
| Parental protein coverage: | 73.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDR-NKPFKFMLGKQEVIRGWEEGVAQMSV |
| MGVQVETISPGD..T..KRGQT.V.HYTGMLEDGKKF.SSRDR..KPFK.MLGKQEVI.GWEEGV..MS. | |
| Retrocopy | MGVQVETISPGDAHTLLKRGQTWVMHYTGMLEDGKKFCSSRDR<KKPFKLMLGKQEVIPGWEEGVVHMSA |
| Parental | GQRAKLTISP |
| GQ.AKLTISP | |
| Retrocopy | GQTAKLTISP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002835 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |