RetrogeneDB ID: | retro_cjac_856 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 11:54901553..54901772(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C1D | ||
Ensembl ID: | ENSCJAG00000006589 | ||
Aliases: | None | ||
Description: | C1D nuclear receptor corepressor [Source:HGNC Symbol;Acc:29911] |
Percent Identity: | 74.67 % |
Parental protein coverage: | 53.19 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEH |
VEIHE....FEN.IGAVD.MLKTMMS...NELLQKLD.LEQ.KVDLVS.YTLN..F.VYL.T.G.NPKEH | |
Retrocopy | VEIHEFF--FENYIGAVDDMLKTMMSAF*NELLQKLDSLEQVKVDLVSVYTLNLKFCVYLSTKGINPKEH |
Parental | PVKQE |
.VKQE | |
Retrocopy | LVKQE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 5 .46 RPM |
SRP051959_heart | 0 .00 RPM | 6 .38 RPM |
SRP051959_kidney | 0 .00 RPM | 14 .84 RPM |
SRP051959_liver | 0 .00 RPM | 10 .09 RPM |
SRP051959_lung | 0 .02 RPM | 7 .50 RPM |
SRP051959_lymph_node | 0 .00 RPM | 6 .14 RPM |
SRP051959_skeletal_muscle | 0 .02 RPM | 11 .73 RPM |
SRP051959_spleen | 0 .02 RPM | 8 .82 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_904 |
Pan troglodytes | retro_ptro_624 |
Gorilla gorilla | retro_ggor_731 |
Macaca mulatta | retro_mmul_1109 |