RetrogeneDB ID: | retro_dnov_1474 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_211890:3256..3497(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000007933 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SMIM20 | ||
Ensembl ID: | ENSDNOG00000004966 | ||
Aliases: | None | ||
Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
Percent Identity: | 75.31 % |
Parental protein coverage: | 79.21 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | EGCLAGQGCP-PGAMSRNLRTALVFGGFISLLGAVFYPIYFRPLLRLEEYQKEQAINRAGIVQADVQPPG |
EG.LA.QGCP.PG.MS.NLRT...F.GFISLLGA.FY.IYF.PL..LEEY.KEQAINRAGI.Q.DVQP.G | |
Retrocopy | EGYLADQGCP>PGTMSCNLRTTFIFVGFISLLGAFFYLIYFWPLMWLEEY*KEQAINRAGIFQVDVQPLG |
Parental | LKVWSDPFGRK |
LKVW..PFGRK | |
Retrocopy | LKVWFYPFGRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 19 .06 RPM |
SRP012922_cerebellum | 0 .00 RPM | 12 .65 RPM |
SRP012922_heart | 0 .00 RPM | 34 .80 RPM |
SRP012922_kidney | 0 .00 RPM | 33 .95 RPM |
SRP012922_liver | 0 .00 RPM | 19 .51 RPM |
SRP012922_lung | 0 .00 RPM | 16 .95 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 37 .91 RPM |
SRP012922_spleen | 0 .00 RPM | 22 .89 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies |
retro_dnov_1474 , retro_dnov_1529,
|
Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |