RetrogeneDB ID: | retro_btau_95 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 16:68078642..68078846(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSBTAG00000045729 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C6H4orf52 | ||
Ensembl ID: | ENSBTAG00000003897 | ||
Aliases: | SMIM20, C6H4orf52 | ||
Description: | None |
Percent Identity: | 100. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK |
MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK | |
Retrocopy | MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .07 RPM | 3 .24 RPM |
ERP005899_muscle | 0 .11 RPM | 9 .03 RPM |
SRP017611_brain | 0 .05 RPM | 3 .43 RPM |
SRP017611_kidney | 0 .06 RPM | 5 .10 RPM |
SRP017611_liver | 0 .00 RPM | 2 .72 RPM |
SRP030211_testis | 0 .35 RPM | 3 .66 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003897 | 1 retrocopy |
retro_btau_95 ,
|
Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |