RetrogeneDB ID: | retro_btau_95 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 16:68078642..68078846(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000045729 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C6H4orf52 | ||
| Ensembl ID: | ENSBTAG00000003897 | ||
| Aliases: | SMIM20, C6H4orf52 | ||
| Description: | None |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK |
| MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK | |
| Retrocopy | MSRNLRTALIFGGFISLIGAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDPFGRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 3 .24 RPM |
| ERP005899_muscle | 0 .11 RPM | 9 .03 RPM |
| SRP017611_brain | 0 .05 RPM | 3 .43 RPM |
| SRP017611_kidney | 0 .06 RPM | 5 .10 RPM |
| SRP017611_liver | 0 .00 RPM | 2 .72 RPM |
| SRP030211_testis | 0 .35 RPM | 3 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003897 | 1 retrocopy |
retro_btau_95 ,
|
| Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |