RetrogeneDB ID: | retro_meug_147 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | GeneScaffold_4313:69272..69501(+) | ||
| Located in intron of: | ENSMEUG00000005388 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SMIM20 | ||
| Ensembl ID: | ENSMEUG00000002680 | ||
| Aliases: | None | ||
| Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
| Percent Identity: | 57.14 % |
| Parental protein coverage: | 75.76 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | VLPDLPSS-VMSRNLRTTMIFGGFALLLGAAFYPIYFRPLMRTEEYKVEQAMNDR-IVQADMQPPGLKVW |
| ..P..PS..V.S..L.T..IF...A.LLGA.FY.I.F.PLM.T.EYK...A.N...I.Q.D.QPPGL.VW | |
| Retrocopy | LVPHIPSL>VTSHKLHTMIIFSSLAFLLGATFYLICFWPLMKTKEYKL**AINQADIIQTDVQPPGLTVW |
| Parental | SDPFGRK |
| SDPFGRK | |
| Retrocopy | SDPFGRK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy |
retro_meug_147 ,
|
| Microcebus murinus | ENSMICG00000017222 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |