RetrogeneDB ID: | retro_mmur_868 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | scaffold_11484:9055..9236(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SMIM20 | ||
Ensembl ID: | ENSMICG00000017222 | ||
Aliases: | None | ||
Description: | small integral membrane protein 20 [Source:HGNC Symbol;Acc:37260] |
Percent Identity: | 79.37 % |
Parental protein coverage: | 58.1 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | TALIFGGFAS-LIAAAFYPIYFRPLMRLEEYQQEQAINRAGIVQEDVQPPGLK-VWSDPFGRK |
TALIF.G.AS.L.AAAFYP.YF..LMRLE.YQ.EQAIN.AGIVQE.VQPPGLK..WSDPFGRK | |
Retrocopy | TALIFRGLAS<LVAAAFYPVYFLLLMRLEGYQKEQAINGAGIVQENVQPPGLK<AWSDPFGRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003897 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004966 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000002680 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000017222 | 1 retrocopy |
retro_mmur_868 ,
|
Macaca mulatta | ENSMMUG00000006680 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016894 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000004810 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015052 | 2 retrocopies |