RetrogeneDB ID: | retro_dnov_1843 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_32958:5775..6135(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM213A | ||
| Ensembl ID: | ENSDNOG00000001981 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 213, member A [Source:HGNC Symbol;Acc:28651] |
| Percent Identity: | 70.25 % |
| Parental protein coverage: | 72.02 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | PLYAVVKEQVGHEVQDFQPYFKGEVFLDEKKEFYGPHRRKMMLLGFVRLGVWFNFLRARNGGFSGNLEGE |
| PL.A.VKEQV....QDFQP.FK.EVFLDEKK....P.R..M...GFV.LGVW..F.RA.NGG.SGNLEGE | |
| Retrocopy | PL*AGVKEQVASAAQDFQPCFK-EVFLDEKKKSCRPQR*RMTFMGFVCLGVWYSFCRAWNGGSSGNLEGE |
| Parental | GFVLGGVFVVGPGKQGILLEHREKEFGDKVSLVSVLEAARKIEPQTSTSEK |
| GF.L.GVFVVGPGKQGILL.HREKEF.DK...VSVL.AARKI.PQ.S.S.K | |
| Retrocopy | GFILSGVFVVGPGKQGILLQHREKEFADKGNPVSVLDAARKIKPQPSASKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 34 .62 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 15 .67 RPM |
| SRP012922_heart | 0 .00 RPM | 7 .19 RPM |
| SRP012922_kidney | 0 .55 RPM | 104 .86 RPM |
| SRP012922_liver | 0 .00 RPM | 92 .57 RPM |
| SRP012922_lung | 0 .00 RPM | 13 .44 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
| SRP012922_spleen | 0 .00 RPM | 74 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies |
retro_dnov_1843 , retro_dnov_1901, retro_dnov_868,
|
| Homo sapiens | ENSG00000122378 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
| Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |