RetrogeneDB ID: | retro_dnov_1843 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_32958:5775..6135(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FAM213A | ||
Ensembl ID: | ENSDNOG00000001981 | ||
Aliases: | None | ||
Description: | family with sequence similarity 213, member A [Source:HGNC Symbol;Acc:28651] |
Percent Identity: | 70.25 % |
Parental protein coverage: | 72.02 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | PLYAVVKEQVGHEVQDFQPYFKGEVFLDEKKEFYGPHRRKMMLLGFVRLGVWFNFLRARNGGFSGNLEGE |
PL.A.VKEQV....QDFQP.FK.EVFLDEKK....P.R..M...GFV.LGVW..F.RA.NGG.SGNLEGE | |
Retrocopy | PL*AGVKEQVASAAQDFQPCFK-EVFLDEKKKSCRPQR*RMTFMGFVCLGVWYSFCRAWNGGSSGNLEGE |
Parental | GFVLGGVFVVGPGKQGILLEHREKEFGDKVSLVSVLEAARKIEPQTSTSEK |
GF.L.GVFVVGPGKQGILL.HREKEF.DK...VSVL.AARKI.PQ.S.S.K | |
Retrocopy | GFILSGVFVVGPGKQGILLQHREKEFADKGNPVSVLDAARKIKPQPSASKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 34 .62 RPM |
SRP012922_cerebellum | 0 .00 RPM | 15 .67 RPM |
SRP012922_heart | 0 .00 RPM | 7 .19 RPM |
SRP012922_kidney | 0 .55 RPM | 104 .86 RPM |
SRP012922_liver | 0 .00 RPM | 92 .57 RPM |
SRP012922_lung | 0 .00 RPM | 13 .44 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 5 .02 RPM |
SRP012922_spleen | 0 .00 RPM | 74 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000813 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000003657 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000001981 | 3 retrocopies |
retro_dnov_1843 , retro_dnov_1901, retro_dnov_868,
|
Homo sapiens | ENSG00000122378 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000013246 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000007485 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021773 | 3 retrocopies | |
Mus musculus | ENSMUSG00000021792 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013638 | 7 retrocopies | |
Procavia capensis | ENSPCAG00000009696 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000025862 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000002685 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000011140 | 1 retrocopy |