RetrogeneDB ID: | retro_ecab_258 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 11:959005..959410(-) | ||
| Located in intron of: | ENSECAG00000009928 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LIN28A | ||
| Ensembl ID: | ENSECAG00000020267 | ||
| Aliases: | LIN28A, LIN28 | ||
| Description: | lin-28 homolog A (C. elegans) [Source:HGNC Symbol;Acc:15986] |
| Percent Identity: | 54.79 % |
| Parental protein coverage: | 69.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | EEPQLLHGAGICKWFNVRMGFGFLSMTARAG-VALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSA |
| E.PQL..G.GI.KW.....GF..LS.T...G.V.L..PVDVF..Q.KLH.EGF.S.K.GE..EFTF.KS. | |
| Retrocopy | EQPQLPYGTGIPKWVSAHTGFSSLSTTTAPG<VTLNAPVDVFEPQRKLHTEGFQSPKWGEETEFTFQKST |
| Parental | K-GLESIRVTGPGGVFCIGSERRPKGKNLQKRRSKGDRCYNCGGLDHHAKE-CKLPPQPKKCHFCQSISH |
| K.GLES........VFC.GSER...G.........GD....CGGLD.HAKE..KLP.QPKKC.FCQSISH | |
| Retrocopy | K<GLESYQLLE---VFCTGSERHQRGRT----HTEGDGHSSCGGLDQHAKE<TKLPSQPKKCPFCQSISH |
| Parental | MVASCP |
| ..A..P | |
| Retrocopy | VAAPAP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 0 .00 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP021940_embryo | 0 .10 RPM | 0 .28 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 0 .05 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 0 .00 RPM |
| SRP021940_testis | 0 .00 RPM | 3 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010582 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000040497 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000012488 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009796 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000019646 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010710 | 5 retrocopies | |
| Equus caballus | ENSECAG00000020267 | 1 retrocopy |
retro_ecab_258 ,
|
| Homo sapiens | ENSG00000131914 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000024918 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010158 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000009294 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000000299 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000003971 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001684 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000000384 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017267 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000038409 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003557 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000004329 | 1 retrocopy |