RetrogeneDB ID: | retro_ecab_414 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 17:33230196..33230551(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL31 | ||
| Ensembl ID: | ENSECAG00000024079 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L31 [Source:HGNC Symbol;Acc:10334] |
| Percent Identity: | 67.46 % |
| Parental protein coverage: | 99.2 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | APAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMG-TPDVRIDTRLNK |
| AP.KKGGEK..G.SAI.EVVTREYTI.IHK.I.GV..KK.AP..LK.I.K..MKEMG...DV.IDTRL.K | |
| Retrocopy | APVKKGGEK--GLSAIIEVVTREYTIIIHKCIYGV-VKK*APSTLKRILKSTMKEMG<NSDVHIDTRLTK |
| Parental | AVWAKGIRNVP-YRIRVRLSRKRNEDEDSPNKLYTLVTYVPVTTFKNLQTVNVDEN |
| AVWAKGIRN.P.Y.I.V.LS....E.E.SPNKLY...TY..VT.FK.LQ.VNVDEN | |
| Retrocopy | AVWAKGIRNAP<YCICVWLSS--DEYEESPNKLYAFFTYIIVTIFKTLQAVNVDEN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 327 .91 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 157 .98 RPM |
| SRP021940_embryo | 0 .00 RPM | 312 .70 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 177 .00 RPM |
| SRP021940_synovial_membrane | 0 .03 RPM | 274 .11 RPM |
| SRP021940_testis | 0 .00 RPM | 148 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1269 |
| Gorilla gorilla | retro_ggor_997 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000021031 | 5 retrocopies | |
| Equus caballus | ENSECAG00000024079 | 13 retrocopies | |
| Latimeria chalumnae | ENSLACG00000013603 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000027873 | 12 retrocopies | |
| Macropus eugenii | ENSMEUG00000000963 | 8 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002507 | 21 retrocopies |
retro_mluc_1072, retro_mluc_1135, retro_mluc_1239, retro_mluc_1301, retro_mluc_1406, retro_mluc_1470, retro_mluc_1666, retro_mluc_1678, retro_mluc_1896, retro_mluc_1913, retro_mluc_2028, retro_mluc_2124, retro_mluc_2126, retro_mluc_269, retro_mluc_303, retro_mluc_463, retro_mluc_767, retro_mluc_782, retro_mluc_914, retro_mluc_922, retro_mluc_997,
|
| Mustela putorius furo | ENSMPUG00000012197 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000014494 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000025870 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000008170 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000025180 | 6 retrocopies |