RetrogeneDB ID: | retro_ggor_997 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 13:39706420..39706626(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL31 | ||
| Ensembl ID: | ENSGGOG00000006432 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.57 % |
| Parental protein coverage: | 55.2 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | TREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRI-DTRLNKAVWAKGIRNVPYRIRVRLSR |
| TRE.....HK...GVGFKK..P..L.EI.KF.MK.M..PDV...DTRLNK.V.AK.IRN.PY.I..RLS. | |
| Retrocopy | TRE*SEDTHKCTCGVGFKKHVP*QLREIQKFSMKKMEMPDVLL<DTRLNKVV*AKEIRNLPYHIYERLSK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 115 .33 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 89 .63 RPM |
| SRP007412_heart | 0 .00 RPM | 55 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 292 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 317 .14 RPM |
| SRP007412_testis | 0 .00 RPM | 156 .44 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1269 |
| Equus caballus | retro_ecab_414 |