RetrogeneDB ID: | retro_ggor_997 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 13:39706420..39706626(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL31 | ||
Ensembl ID: | ENSGGOG00000006432 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 58.57 % |
Parental protein coverage: | 55.2 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | TREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPDVRI-DTRLNKAVWAKGIRNVPYRIRVRLSR |
TRE.....HK...GVGFKK..P..L.EI.KF.MK.M..PDV...DTRLNK.V.AK.IRN.PY.I..RLS. | |
Retrocopy | TRE*SEDTHKCTCGVGFKKHVP*QLREIQKFSMKKMEMPDVLL<DTRLNKVV*AKEIRNLPYHIYERLSK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 115 .33 RPM |
SRP007412_cerebellum | 0 .00 RPM | 89 .63 RPM |
SRP007412_heart | 0 .00 RPM | 55 .72 RPM |
SRP007412_kidney | 0 .00 RPM | 292 .60 RPM |
SRP007412_liver | 0 .00 RPM | 317 .14 RPM |
SRP007412_testis | 0 .00 RPM | 156 .44 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1269 |
Equus caballus | retro_ecab_414 |