RetrogeneDB ID: | retro_ecab_817 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 4:66911765..66912004(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP14 | ||
| Ensembl ID: | ENSECAG00000000319 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 14kDa (homologous Alu RNA binding protein) [Source:HGNC Symbol;Acc:11299] |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 74.55 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TLKKYDGRTKPIPRKGSVEGFEPSDNKCLLRATDGKKKISTVVSSKE-VNKFQMAYSNLLRANMDGLKKR |
| TLK.YDG.T..IPRKGSVEGF.P.DN.CLLRA..GKK..STVVSSKE....FQMAYSNL.RA.MDGL..R | |
| Retrocopy | TLKRYDGQTILIPRKGSVEGFKP*DNHCLLRAAVGKKQLSTVVSSKE<MSEFQMAYSNLSRAYMDGLNER |
| Parental | DKKSKSKKSKAAQ |
| D..SK.K..KAAQ | |
| Retrocopy | D--SKRKRGKAAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 30 .05 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 62 .27 RPM |
| SRP021940_embryo | 0 .00 RPM | 34 .04 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 42 .82 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 33 .85 RPM |
| SRP021940_testis | 0 .00 RPM | 73 .53 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000029889 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020912 | 3 retrocopies | |
| Equus caballus | ENSECAG00000000319 | 1 retrocopy |
retro_ecab_817 ,
|
| Echinops telfairi | ENSETEG00000011870 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009921 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007637 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016061 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000029204 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008324 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029070 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006342 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002186 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015627 | 9 retrocopies | |
| Tursiops truncatus | ENSTTRG00000000036 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000010282 | 1 retrocopy |