RetrogeneDB ID: | retro_eeur_634 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_371511:43738..43963(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SS18L2 | ||
Ensembl ID: | ENSEEUG00000014065 | ||
Aliases: | None | ||
Description: | synovial sarcoma translocation gene on chromosome 18-like 2 [Source:HGNC Symbol;Acc:15593] |
Percent Identity: | 85.33 % |
Parental protein coverage: | 98.67 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSVAFVPDWMRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRAHECVQ-RQVLHRNLIYLASIADASPT |
MSVAFV.DWMRGKAEVNQETIQRLLEENDQLI.CIV.YQNKGRAHECVQ..QVL.R.LI.LA..ADASPT | |
Retrocopy | MSVAFVLDWMRGKAEVNQETIQRLLEENDQLICCIVKYQNKGRAHECVQYQQVLPRKLIFLATTADASPT |
Parental | NTAKE |
NTAK. | |
Retrocopy | NTAKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 6 .28 RPM |
SRP017611_kidney | 0 .00 RPM | 4 .88 RPM |
SRP017611_liver | 0 .00 RPM | 3 .54 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy |
retro_eeur_634 ,
|
Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |