RetrogeneDB ID: | retro_opri_542 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | scaffold_16433:52072..52288(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOPRG00000015198 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSVAFVPDWLRGSAEINQETIQRLLEENDQLIRCIVEYQNKGRAHECVQYQHVLHRNLIYLATIADASPA |
MSVAF.PDWL.GSAEINQET.QRLLEENDQLIRCI..YQNKG.AHECVQYQHVLHRN.IY.ATI.DASPA | |
Retrocopy | MSVAFIPDWLWGSAEINQETTQRLLEENDQLIRCIMQYQNKGQAHECVQYQHVLHRNFIYIATITDASPA |
Parental | ST |
ST | |
Retrocopy | ST |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
Homo sapiens | ENSG00000008324 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000013979 | 2 retrocopies | |
Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |