RetrogeneDB ID: | retro_acar_189 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
Coordinates: | GL343414.1:236448..236685(+) | ||
Located in intron of: | ENSACAG00000003580 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SS18L2 | ||
Ensembl ID: | ENSACAG00000000989 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 79.75 % |
Parental protein coverage: | 98.75 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSVVFLPERVRGKAEVNQETLRRLMDENDQLIRCIVEYQNKGRAAECMQLQHTLHRNLIYLATIADASAS |
M.VVFLPERV.GK.E.NQE.L.RLMDENDQLIR.IVEYQNKGRA...MQLQHTL.RNLIYLA.IADA.AS | |
Retrocopy | MLVVFLPERVWGKVEMNQEMLQRLMDENDQLIRFIVEYQNKGRAVKYMQLQHTLCRNLIYLAMIADAPAS |
Parental | SNAEKAAAE |
SN..KAAA. | |
Retrocopy | SNTKKAAAD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP009831_adrenal | 0 .16 RPM | 37 .75 RPM |
SRP009831_brain | 0 .14 RPM | 17 .47 RPM |
SRP009831_dewlap | 0 .00 RPM | 55 .39 RPM |
SRP009831_embryo | 0 .03 RPM | 20 .27 RPM |
SRP009831_heart | 0 .10 RPM | 18 .83 RPM |
SRP009831_liver | 0 .00 RPM | 29 .69 RPM |
SRP009831_lung | 0 .55 RPM | 22 .21 RPM |
SRP009831_ovary | 0 .00 RPM | 54 .28 RPM |
SRP009831_skeletal_muscle | 0 .00 RPM | 14 .13 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy |
retro_acar_189 ,
|
Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
Homo sapiens | ENSG00000008324 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000013979 | 2 retrocopies | |
Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |