RetrogeneDB ID: | retro_lafr_754 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_35:14498750..14498980(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSLAFG00000021542 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.08 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MSVAFVPDWLRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRANECVQY-QHVLHRNLIYLATIADASP |
M.VAFV.DWL.GKAEVNQETI..LL.ENDQLI.CI.EYQNKG..NE...Y.QHVLHRNLIYLAT..DASP | |
Retrocopy | MLVAFVLDWLQGKAEVNQETI*WLLGENDQLIHCIREYQNKGWSNEYIRY<QHVLHRNLIYLATVVDASP |
Parental | TSTAKSME |
T...KS.. | |
Retrocopy | TGASKSLD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
Homo sapiens | ENSG00000008324 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies |
retro_lafr_754 , retro_lafr_92,
|
Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000013979 | 2 retrocopies | |
Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |