RetrogeneDB ID: | retro_opri_516 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_14746:53302..53516(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSOPRG00000015198 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.14 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MSVAFVPDWLR-GSAEINQET-IQRLLEENDQLIRCIVEYQNKGRAHECVQYQHVLHRNLIYLATIADAS |
| MSVA..PDWLR.GSAEI.QET.IQRLL.ENDQLIRC.VE.QNK..AHECVQYQHVLHRNLIYLAT.ADAS | |
| Retrocopy | MSVAVGPDWLR<GSAEISQET<IQRLLQENDQLIRCMVECQNKDPAHECVQYQHVLHRNLIYLATTADAS |
| Parental | PAST |
| PAST | |
| Retrocopy | PAST |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
| Homo sapiens | ENSG00000008324 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000031677 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005848 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000013979 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |