RetrogeneDB ID: | retro_etel_1168 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_221210:4365..4610(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL36 | ||
| Ensembl ID: | ENSETEG00000012943 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L36 [Source:HGNC Symbol;Acc:13631] |
| Percent Identity: | 68.67 % |
| Parental protein coverage: | 78.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | PMAVGLDKGHKVTKNVSKPRHSRR-RGXXXXXXXXXXXMIREVCGFAPYERRAMELLKVSKDKRALKFIK |
| P.A.GL.KGHKVT.NVSKPR.SR..RG............I.E.CGF.P.E..AMELLKVSKDKRALKFIK | |
| Retrocopy | PVAMGLSKGHKVTMNVSKPRPSRH<RGRLSKHTKVMRDRIWEACGFVPSEQQAMELLKVSKDKRALKFIK |
| Parental | KRVGTHIRAKRKR |
| KRVG.HIRAKRKR | |
| Retrocopy | KRVGAHIRAKRKR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012349 | 6 retrocopies | |
| Bos taurus | ENSBTAG00000001794 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000017072 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000005163 | 8 retrocopies | |
| Echinops telfairi | ENSETEG00000012943 | 15 retrocopies | |
| Felis catus | ENSFCAG00000011838 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015365 | 11 retrocopies | |
| Latimeria chalumnae | ENSLACG00000015161 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002743 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000001275 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006166 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000057863 | 9 retrocopies | |
| Otolemur garnettii | ENSOGAG00000027049 | 12 retrocopies | |
| Pongo abelii | ENSPPYG00000009431 | 12 retrocopies | |
| Rattus norvegicus | ENSRNOG00000033473 | 5 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000013492 | 8 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020518 | 2 retrocopies |