RetrogeneDB ID: | retro_fcat_475 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:65360475..65360690(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSFCAG00000010591 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 60.27 % |
| Parental protein coverage: | 55.04 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | GLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYR-GGFEPKMTK-REAALILGISPTANKG |
| GL..A...FAG..V.QA..H.EP.VK..FQ....SAFSGGY.R..GFEP..TK..EAALIL.ISPTAN.G | |
| Retrocopy | GLATAVVRFAGCSVSQATEHVEPHVKHIFQNISRSAFSGGYHR>SGFEPQITK>GEAALILSISPTANRG |
| Parental | KIR |
| ..R | |
| Retrocopy | EMR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 13 .31 RPM |
| SRP017611_kidney | 0 .00 RPM | 20 .41 RPM |
| SRP017611_liver | 0 .00 RPM | 38 .52 RPM |