RetrogeneDB ID: | retro_mmur_728 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | GeneScaffold_4873:437529..437730(+) | ||
| Located in intron of: | ENSMICG00000002428 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSMICG00000010381 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 92.54 % |
| Parental protein coverage: | 57.76 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | YRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
| .RGGFEPKMTK.EAALILG.SPTANKGKIRD.HRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQA.K | |
| Retrocopy | FRGGFEPKMTKQEAALILGISPTANKGKIRDVHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |