RetrogeneDB ID: | retro_cjac_2609 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:43968305..43968524(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000012795 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.3 % |
| Parental protein coverage: | 62.93 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQ |
| AFSGGY.R.GFEPKMTKREAALILG.SPTANKGKIRD.H..IMLL.HPDKGGSPYIAA.I.EAKDLLEGQ | |
| Retrocopy | AFSGGYCRSGFEPKMTKREAALILGKSPTANKGKIRDSHQQIMLLTHPDKGGSPYIAAQIHEAKDLLEGQ |
| Parental | AKK |
| .KK | |
| Retrocopy | VKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 12 .94 RPM |
| SRP051959_heart | 0 .02 RPM | 19 .72 RPM |
| SRP051959_kidney | 0 .00 RPM | 27 .20 RPM |
| SRP051959_liver | 0 .00 RPM | 42 .74 RPM |
| SRP051959_lung | 0 .00 RPM | 15 .88 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 17 .10 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 42 .26 RPM |
| SRP051959_spleen | 0 .00 RPM | 17 .50 RPM |