RetrogeneDB ID: | retro_ggor_1351 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 17:55494162..55494568(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PRDX4 | ||
Ensembl ID: | ENSGGOG00000026790 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 54.29 % |
Parental protein coverage: | 50.55 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 3 |
Parental | VFFFYPLDFTFVCPTEIIAFGDRLE-EFRSINTEVVACSVDSQFTHLAWINTPRRQGGL-GPIRIPLLSD |
V.FF..LDFT.VCPT.II.F.D..E.E.R..NTEV..C..DSQFTHL.....PR.Q.GL..P..I..LSD | |
Retrocopy | VYFF--LDFTCVCPTKIINFSDKIE<ELRPLNTEVIPCLADSQFTHLV*SPAPRKQRGL>SPGKISFLSD |
Parental | LTHQISKDYG-VYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAG |
..HQISK.YG..YLE.SGH.LRG.F.ID.KGI.R.....D.PV.R.V...L...Q...YTD..G.V...G | |
Retrocopy | FIHQISKCYG>MYLENSGHSLRGFFTIDEKGIQR*FRMDDPPVSRVVNKILYWGQVSLYTDQYGKVYAVG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .94 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .30 RPM |
SRP007412_heart | 0 .00 RPM | 5 .94 RPM |
SRP007412_kidney | 0 .00 RPM | 17 .30 RPM |
SRP007412_liver | 0 .00 RPM | 67 .05 RPM |
SRP007412_testis | 0 .00 RPM | 44 .65 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3165 |
Macaca mulatta | retro_mmul_2001 |
Equus caballus | retro_ecab_576 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000006165 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000004185 | 1 retrocopy | |
Equus caballus | ENSECAG00000010085 | 1 retrocopy | |
Homo sapiens | ENSG00000123131 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000025089 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000026364 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000026790 | 1 retrocopy |
retro_ggor_1351 ,
|
Myotis lucifugus | ENSMLUG00000004904 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021366 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004454 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000000602 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012368 | 1 retrocopy |