RetrogeneDB ID: | retro_ggor_1785 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2b:69029789..69030144(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSGGOG00000001660 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 81.82 % |
Parental protein coverage: | 79.87 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | KHRKHPGGRGNAGGLHH-HRINFDKYHPGYFGKVGMKHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAK |
KH.KHPGGRG.AGG.HH.HRINFDKYHPGYFGKVGM.HYHLKRNQSFCP.VNLDKLWTLV.EQT.V..AK | |
Retrocopy | KHWKHPGGRGKAGGMHH<HRINFDKYHPGYFGKVGMRHYHLKRNQSFCPAVNLDKLWTLVREQTWVKVAK |
Parental | NKTGAAPIIDVVRSGYYKVLGKGKLPKQ-PVIVKAKFFSRRAEEKIKSVGG |
NKTGAAPI.DVV..G..KVL.KGKLPKQ..VIVKAKFFSRRA.E.IK.V.G | |
Retrocopy | NKTGAAPIVDVV*PGN*KVLEKGKLPKQ<AVIVKAKFFSRRAKEMIKGVRG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 47 .67 RPM |
SRP007412_cerebellum | 0 .00 RPM | 69 .07 RPM |
SRP007412_heart | 0 .00 RPM | 57 .97 RPM |
SRP007412_kidney | 0 .00 RPM | 138 .33 RPM |
SRP007412_liver | 0 .00 RPM | 161 .57 RPM |
SRP007412_testis | 0 .00 RPM | 81 .64 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2352 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ficedula albicollis | ENSFALG00000000924 | 1 retrocopy | |
Homo sapiens | ENSG00000166441 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000001660 | 2 retrocopies |
retro_ggor_155, retro_ggor_1785 ,
|
Myotis lucifugus | ENSMLUG00000016616 | 7 retrocopies | |
Macaca mulatta | ENSMMUG00000021828 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000007480 | 1 retrocopy | |
Mus musculus | ENSMUSG00000046364 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000003333 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014214 | 10 retrocopies | |
Tupaia belangeri | ENSTBEG00000000046 | 20 retrocopies |
retro_tbel_1093, retro_tbel_1101, retro_tbel_1148, retro_tbel_1152, retro_tbel_1223, retro_tbel_1338, retro_tbel_1639, retro_tbel_2017, retro_tbel_2606, retro_tbel_2777, retro_tbel_298, retro_tbel_3111, retro_tbel_3496, retro_tbel_3881, retro_tbel_4566, retro_tbel_460, retro_tbel_544, retro_tbel_643, retro_tbel_925, retro_tbel_937,
|
Taeniopygia guttata | ENSTGUG00000008355 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013207 | 16 retrocopies |