RetrogeneDB ID: | retro_tgut_18 | ||
Retrocopy location | Organism: | Zebrafinch (Taeniopygia guttata) | |
| Coordinates: | 2:58740472..58740902(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27A | ||
| Ensembl ID: | ENSTGUG00000008355 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27a [Source:HGNC Symbol;Acc:10329] |
| Percent Identity: | 63.51 % |
| Parental protein coverage: | 98.65 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | PSRLRKTRKLRGHVSHGHGRV-GKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMRHYHLKRNQKFC |
| P.RLR.T.KLRGH.SH.H.....KH....G...NAGG..HHR.NF.KYH.GYF.KVGM.H.HLKRNQKFC | |
| Retrocopy | PFRLRVTQKLRGHISHSHMHI>RKHPRGRG---NAGGMQHHRMNFYKYHSGYFRKVGMTHCHLKRNQKFC |
| Parental | PTVNLDKLWTLVSEQTRLNYAKNEAGLAPVIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEK-IKE |
| .TVNL.KLWT..SE....NY.KNEA.LA.V.D...SGYYK.LGKG.L.KQ...VKAKFFS.....K.IKE | |
| Retrocopy | ATVNL-KLWTTISE*KMFNYMKNEASLASVTDTMHSGYYKILGKGNLHKQLPVVKAKFFS*SL*GKKIKE |
| Parental | VGGACVLV |
| VG.ACV.V | |
| Retrocopy | VGSACVFV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004205 | 15 retrocopies | |
| Bos taurus | ENSBTAG00000005349 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006936 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011775 | 1 retrocopy | |
| Ficedula albicollis | ENSFALG00000000924 | 1 retrocopy | |
| Felis catus | ENSFCAG00000008411 | 13 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001660 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000000425 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016616 | 7 retrocopies | |
| Macaca mulatta | ENSMMUG00000021828 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000012532 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000046364 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017535 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005442 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003333 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014214 | 10 retrocopies | |
| Sus scrofa | ENSSSCG00000014569 | 9 retrocopies | |
| Taeniopygia guttata | ENSTGUG00000008355 | 1 retrocopy |
retro_tgut_18 ,
|
| Tarsius syrichta | ENSTSYG00000013207 | 16 retrocopies |