RetrogeneDB ID: | retro_ggor_1836 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 3:28455234..28455620(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TPM4 | ||
| Ensembl ID: | ENSGGOG00000014510 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 74.62 % |
| Parental protein coverage: | 52.02 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKED-KYEEE |
| EEADRKYEEVARKLVILEGELERAEERAEVSELKCGD.EEELKNV.NN.KSLEAASEKYSEKED...EEE | |
| Retrocopy | EEADRKYEEVARKLVILEGELERAEERAEVSELKCGDVEEELKNVSNNVKSLEAASEKYSEKED<QCEEE |
| Parental | IKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSL |
| IKLL.DKLKE.ETRAE.AER.VA.LEKT.DDLE..L...K.........LD..LN..... | |
| Retrocopy | IKLLCDKLKEDETRAECAERAVANLEKTMDDLEEYLVQAKEENVGLHQTLDQTLNEVNCI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .58 RPM | 39 .56 RPM |
| SRP007412_cerebellum | 0 .39 RPM | 70 .96 RPM |
| SRP007412_heart | 0 .28 RPM | 22 .20 RPM |
| SRP007412_kidney | 0 .49 RPM | 21 .75 RPM |
| SRP007412_liver | 0 .66 RPM | 20 .60 RPM |
| SRP007412_testis | 4 .35 RPM | 113 .34 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004553 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000015796 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014135 | 1 retrocopy | |
| Homo sapiens | ENSG00000167460 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012668 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014510 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000014882 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031799 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005413 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009884 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000010637 | 10 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000009755 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024252 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012927 | 7 retrocopies | |
| Tarsius syrichta | ENSTSYG00000010642 | 9 retrocopies | |
| Tursiops truncatus | ENSTTRG00000014542 | 2 retrocopies |