RetrogeneDB ID: | retro_ggor_2576 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:24828443..24828711(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO2 | ||
| Ensembl ID: | ENSGGOG00000023769 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.76 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MADEKPKEGVKTENNDHINLK-VAGQDGSVVQFKIKRHTPLSKLMKAYCER-QGLSMRQIRFRFDGQPIN |
| MAD.KPK.GVKT..N.HI.L..V.G..GSVVQ......T.LSKLM.AYC.....LSMRQ..F..DG.PIN | |
| Retrocopy | MADKKPKKGVKTQKNNHIELQ<VVGWNGSVVQLQ---STSLSKLMRAYC*Q<TDLSMRQLGFGCDGRPIN |
| Parental | ETDTPAQLEMEDEDTIDVFQQQTGGVY |
| E..TP.Q..MEDED.IDV...QTG..Y | |
| Retrocopy | E--TPVQVKMEDEDIIDVYTKQTGSIY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .29 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .20 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .93 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .30 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .05 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_2605 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000004724 | 1 retrocopy | |
| Homo sapiens | ENSG00000188612 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023769 | 3 retrocopies |
retro_ggor_101, retro_ggor_184, retro_ggor_2576 ,
|
| Gorilla gorilla | ENSGGOG00000026439 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000025811 | 10 retrocopies | |
| Monodelphis domestica | ENSMODG00000007222 | 11 retrocopies | |
| Mus musculus | ENSMUSG00000020738 | 19 retrocopies |
retro_mmus_1498, retro_mmus_1772, retro_mmus_1903, retro_mmus_2050, retro_mmus_2323, retro_mmus_2475, retro_mmus_2492, retro_mmus_2590, retro_mmus_2767, retro_mmus_2917, retro_mmus_2974, retro_mmus_3209, retro_mmus_3414, retro_mmus_3630, retro_mmus_415, retro_mmus_611, retro_mmus_689, retro_mmus_818, retro_mmus_827,
|
| Oryctolagus cuniculus | ENSOCUG00000028195 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000029777 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000005720 | 8 retrocopies |