RetrogeneDB ID: | retro_mdom_517 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:129872555..129872741(-) | ||
Located in intron of: | ENSMODG00000013158 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000007222 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.74 % |
Parental protein coverage: | 65.26 % |
Number of stop codons detected: | 6 |
Number of frameshifts detected | 0 |
Parental | IKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGIY |
IKR.TPL.KLMKAYC....LSMR.I...FDG.PINETD.PA.LEME.E.TIDVFQ....G.Y | |
Retrocopy | IKRNTPLGKLMKAYC***VLSMRYIGL*FDGHPINETDPPA*LEMEGEYTIDVFQL*NEGVY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |