RetrogeneDB ID: | retro_itri_871 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393336.1:1042229..1042455(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS26 | ||
| Ensembl ID: | ENSSTOG00000010559 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S26 [Source:HGNC Symbol;Acc:10414] |
| Percent Identity: | 52.63 % |
| Parental protein coverage: | 64.91 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | IRNIVEAAAVRDISEASVFDAYVLPKLYVKLHY-C-VSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAP |
| ..NIV.A.AVRDIS..SV...YVL.KL.....Y.C..S.AI.SKV.RN.S.EA.KD...PP.FR..GA.. | |
| Retrocopy | MQNIVKATAVRDISKVSVLEVYVLSKLCGMMCY>CELSWAIPSKVIRNPSHEALKD*SFPP*FRSVGATT |
| Parental | RPPPKP |
| ..P..P | |
| Retrocopy | *LPHSP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |