RetrogeneDB ID: | retro_itri_900 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393340.1:933963..934187(-) | ||
| Located in intron of: | ENSSTOG00000001120 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2V2 | ||
| Ensembl ID: | ENSSTOG00000021769 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2 variant 2 [Source:HGNC Symbol;Acc:12495] |
| Percent Identity: | 51.28 % |
| Parental protein coverage: | 52.41 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LEDDEDMTLTRWTGMIIGPPRTNYENRIYSL-KVECGPKYPEAPPS-VRFVTKINMNGINNSSGMVDARS |
| LE.DE..T..RWTG...G.PRT.YE...Y.L.K........EA.PS..R.V..IN....NNSSG.V.ARS | |
| Retrocopy | LEEDEHETPKRWTGVMTGTPRTDYEDKRYKLLKQDVNTEHSEA-PS<LRSVIWIN-KPLNNSSGTVGARS |
| Parental | IPVLAKWQ |
| .P.L.KWQ | |
| Retrocopy | TPELVKWQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000023218 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018575 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014322 | 6 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000021769 | 2 retrocopies |
retro_itri_568, retro_itri_900 ,
|