RetrogeneDB ID: | retro_lafr_543 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_20:19343050..19343226(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL2 | ||
Ensembl ID: | ENSLAFG00000017065 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.33 % |
Parental protein coverage: | 50.43 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | KEDHSLEHRCVESAKIRAKYPDR-VPVSVPGVRGLGIVDIDKRKYLVPSDITVAQFMWII |
..DH.LEHR...S..I...YPD..V......V.G..IVD.DK.KYLVPSD..VAQFM..I | |
Retrocopy | RTDHLLEHRSI*SL*IQERYPDK<VQMIMGKVPGSQIVDTDKQKYLVPSDFSVAQFMCLI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
Homo sapiens | ENSG00000034713 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies |
retro_lafr_234, retro_lafr_543 ,
|
Loxodonta africana | ENSLAFG00000023364 | 3 retrocopies | |
Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |