RetrogeneDB ID: | retro_mluc_1207 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429807:406450..406693(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL2 | ||
Ensembl ID: | ENSMLUG00000015112 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.42 % |
Parental protein coverage: | 69.23 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
MKW.FKEDHSLEHRCVES.KI.AKYP.RVPV..EKVSGS...DIDKRKYLVPSDITVA.FMW.IRKRIQL | |
Retrocopy | MKWVFKEDHSLEHRCVESPKI*AKYPNRVPVSMEKVSGSPAADIDKRKYLVPSDITVAPFMWNIRKRIQL |
Parental | PSEKAIFLFVD |
PSEKAIFLFVD | |
Retrocopy | PSEKAIFLFVD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
Homo sapiens | ENSG00000034713 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy |
retro_mluc_1207 ,
|
Myotis lucifugus | ENSMLUG00000015596 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |