RetrogeneDB ID: | retro_ptro_2794 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 8:117571161..117571514(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL2 | ||
Ensembl ID: | ENSPTRG00000008362 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.43 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 5 |
Number of frameshifts detected | 1 |
Parental | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQL |
.K..FKE.HSLEHRC.ESAKI.AKYPD.V.VIVEKVSGSQ.V..D....L.P.D.TVAQ...I.RKRIQL | |
Retrocopy | IK*IFKEEHSLEHRCTESAKI*AKYPDQVLVIVEKVSGSQVVNTDNQRKLGPVDATVAQLI*ITRKRIQL |
Parental | PSEKAIFLFVDKTVPQSSLTMGQL-YEKEKDEDGFLYV-AYSGENTFGF |
PSEK.IFLFV.KTVP.SSLTMGQL...KEKDED.FLYV.AYS..N..GF | |
Retrocopy | PSEKEIFLFVNKTVP*SSLTMGQL<FQKEKDED*FLYVLAYSTWNILGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .02 RPM | 101 .90 RPM |
SRP007412_cerebellum | 0 .00 RPM | 92 .31 RPM |
SRP007412_heart | 0 .00 RPM | 56 .57 RPM |
SRP007412_kidney | 0 .00 RPM | 60 .78 RPM |
SRP007412_liver | 0 .00 RPM | 19 .15 RPM |
SRP007412_testis | 0 .00 RPM | 40 .89 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4115 |
Pongo abelii | retro_pabe_3368 |
Macaca mulatta | retro_mmul_2369 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000005453 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000002240 | 2 retrocopies | |
Homo sapiens | ENSG00000034713 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017065 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000015112 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005759 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013048 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007565 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000008362 | 2 retrocopies |
retro_ptro_250, retro_ptro_2794 ,
|
Pan troglodytes | ENSPTRG00000008445 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000019425 | 1 retrocopy |