RetrogeneDB ID: | retro_lafr_612 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_25:18909403..18909643(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL24 | ||
| Ensembl ID: | ENSLAFG00000013804 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 75.31 % |
| Parental protein coverage: | 50.62 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKR |
| ...L.SFS..KIY.GH.R.YA....KVFQFLNAK.E.AFLSKRNPRQINWTVLY.RKHKKGQSE.IQKKR | |
| Retrocopy | KFKLGSFSRCKIYSGHRRHYASLP-KVFQFLNAKHELAFLSKRNPRQINWTVLYGRKHKKGQSEDIQKKR |
| Parental | TRRAVKFQRAI |
| T..AVKFQ.AI | |
| Retrocopy | TCHAVKFQGAI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |