RetrogeneDB ID: | retro_mdom_1239 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 4:58901939..58902379(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000007447 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 77.48 % |
Parental protein coverage: | 50.87 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MLRRTLENRDAQTKQLQDAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVN----EINAYAATETPNL |
MLRRTLENR.AQTKQLQD.VSN.EKHFG...QIFA..V.KTARL..KADL.VN....EIN.YAAT.TPNL | |
Retrocopy | MLRRTLENREAQTKQLQDVVSNLEKHFG---QIFAT*VGKTARLQYKADLIVNEINGEINSYAATKTPNL |
Parental | KHGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKSYGTIVKMKRDDLKATLTAKSREAKQLTQLE-RTRQ |
KH.LKDFADEFAKLQDY.QAEVERLEAKVVEPLKSYG.IVKMK.DDLKATLTAKS.EA.QLTQLE....Q | |
Retrocopy | KHNLKDFADEFAKLQDYWQAEVERLEAKVVEPLKSYGIIVKMKWDDLKATLTAKS*EANQLTQLE<NHGQ |
Parental | RNPSDRHVISQ |
.NP...HV..Q | |
Retrocopy | WNPPELHVSFQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000009105 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000013003 | 1 retrocopy | |
Homo sapiens | ENSG00000188343 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000006452 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003954 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000006797 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007447 | 2 retrocopies |
retro_mdom_1239 , retro_mdom_827,
|
Mustela putorius furo | ENSMPUG00000009112 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002773 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000002972 | 1 retrocopy | |
Oreochromis niloticus | ENSONIG00000002446 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000011171 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018744 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012502 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000012378 | 1 retrocopy |