RetrogeneDB ID: | retro_mdom_426 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:487553676..487554107(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS18B | ||
Ensembl ID: | ENSMODG00000015933 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein S18B [Source:HGNC Symbol;Acc:14516] |
Percent Identity: | 56.08 % |
Parental protein coverage: | 61.25 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | CIRGNKVSGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGVIFHAPYTGVCMKQHKKLTEAILKARDQGLL |
CI.GNKV..NP.P.C.DQ.L..DFRNV.L.EQFV.A..G.IFHA.YT.VC......LTE..LKAR..G.. | |
Retrocopy | CIYGNKVARNP*PFCWDQNLCKDFRNVRLTEQFVFANIGIIFHASYTVVCL--YEGLTETVLKARHHGFS |
Parental | SYHIPLVQPRDTDFSNSHGAVGLTPMAPALAAGTAWYPWYTWQQPPERELARLRRLYQ-GHLKEESGPPP |
....P...P..T.FSN..G.VG.T.M.PAL.A...WYPWY.WQQ...REL..L..L.Q.GHL..ESG.PP | |
Retrocopy | VTPSPMKKPQNTHFSNFGGTVGFTSMVPALEANVSWYPWYIWQQSSKRELSHLQYLHQ<GHLRVESGLPP |
Parental | EMMPIVPS |
E...IVPS | |
Retrocopy | EIL-IVPS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005581 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012457 | 10 retrocopies | |
Macaca mulatta | ENSMMUG00000006525 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000015933 | 1 retrocopy |
retro_mdom_426 ,
|
Mus musculus | ENSMUSG00000024436 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005224 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000002149 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000016412 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000017932 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000804 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000011853 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000003333 | 1 retrocopy |