RetrogeneDB ID: | retro_rnor_1328 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 18:6057026..6057446(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps18b | ||
| Ensembl ID: | ENSRNOG00000000804 | ||
| Aliases: | Mrps18b, Ptd017 | ||
| Description: | mitochondrial ribosomal protein S18B [Source:RefSeq peptide;Acc:NP_997699] |
| Percent Identity: | 80.71 % |
| Parental protein coverage: | 54.47 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | TRKTCIRKDKVAGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARE |
| .R..C....KVAGNPCPIC.D.KLHVD.RNVKLLEQFVCAHTGIIF.A.YTGVCMKQHKKLTQAIQKAR. | |
| Retrocopy | SRPECMNHNKVAGNPCPICQDQKLHVDIRNVKLLEQFVCAHTGIIFNASYTGVCMKQHKKLTQAIQKARK |
| Parental | YGLLSYYVPQVEPRDADLRTVHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEASG |
| .GLL.YYVPQV.P.D.D.R.VHGAVSVTPP.PTLL.GEPWY.WYSWQQ.PERELSRLRRLYQGN.L..SG | |
| Retrocopy | CGLLIYYVPQVQP*DVDFRIVHGAVSVTPPVPTLLLGEPWYLWYSWQQQPERELSRLRRLYQGNFLKESG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 19 .41 RPM |
| SRP017611_kidney | 0 .00 RPM | 34 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 24 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005581 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012457 | 10 retrocopies | |
| Macaca mulatta | ENSMMUG00000006525 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000015933 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024436 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005224 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000002149 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016412 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017932 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000804 | 1 retrocopy |
retro_rnor_1328 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000011853 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000003333 | 1 retrocopy |